Dnajc17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dnajc17 antibody: synthetic peptide directed towards the middle region of mouse Dnajc17. Synthetic peptide located within the following region: RQDREQRLRGRTENTEGKGTPKLKLKWKCKKEDESQGGYSRDVLLRLLQK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	DnaJ heat shock protein family (Hsp40) member C17
Database Link	NP_631878 Entrez Gene 69408 Mouse UniProt ID Q91WT4
Background	The function of the protein remains unknown.
Synonyms	FLJ10634
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 92%; Human: 92%; Guinea pig: 92%; Horse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.