PC4 (SUB1) Rabbit Polyclonal Antibody

CAT#: TA330155

Rabbit Polyclonal Anti-SUB1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of SUB1 homolog (S. cerevisiae) (SUB1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human SUB1 homolog (S. cerevisiae) (SUB1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human SUB1 homolog (S. cerevisiae) (SUB1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PC4 antibody: synthetic peptide directed towards the middle region of human PC4. Synthetic peptide located within the following region: NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 14 kDa
Gene Name SUB1 homolog, transcriptional regulator
Background PC4 (activated RNA polymerase II transcription cofactor 4) is a transcriptional coactivator, possessing the ability to suppress promoter-driven as well as nonspecific transcription via its DNA binding activity. The repressive activity of PC4 on promoter-driven transcription is alleviated by transcription factor TFIIH. TFIIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity.
Synonyms p14; P15; PC4
Note Immunogen sequence homology: Bovine:100%; Human:100%; African clawed frog:100%; Western clawed frog:100%; Rat:100%; Chicken:100%; Sumatran orangutan:100%; Zebrafish:100%; Crab-eating macaque:100%; Mouse:100%; Dog:100%; salmon louse:100%; Northern pike:100
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...