ZKSCAN5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZKSCAN5 antibody: synthetic peptide directed towards the N terminal of human ZKSCAN5. Synthetic peptide located within the following region: VKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	97 kDa
Gene Name	zinc finger with KRAB and SCAN domains 5
Database Link	NP_659570 Entrez Gene 23660 Human UniProt ID Q9Y2L8
Background	ZKSCAN5 may be involved in transcriptional regulation.This gene encodes a zinc finger protein of the Kruppel family. The protein contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis. Two alternatively spliced transcript variants differing only in the 5' UTR have been described. Additional variants have been found, but their full-length sequences have not been determined.
Synonyms	ZFP95; ZNF914; ZSCAN37
Note	Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.