PYCR3 Rabbit Polyclonal Antibody
CAT#: TA330721
Rabbit Polyclonal Anti-PYCRL Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PYCRL antibody is: synthetic peptide directed towards the N-terminal region of Human PYCRL. Synthetic peptide located within the following region: LIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFAT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 29 kDa |
Gene Name | pyrroline-5-carboxylate reductase-like |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | PYCR3 |
Note | Rat: 100%; Human: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Mouse: 85%; Bovine: 79% |
Reference Data | |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |