ANKFY1 Rabbit Polyclonal Antibody
CAT#: TA331370
Rabbit Polyclonal Anti-ANKFY1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the C-terminal region of Human ANKFY1. Synthetic peptide located within the following region: VNGTSFDENSFAARLIQRGSHTDAPDTATGKARASRRGDAGVCRRQEMAC |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | ankyrin repeat and FYVE domain containing 1 |
Database Link | |
Background | This gene encodes a cytoplasmic protein that contains a coiled-coil structure and a BTB/POZ domain at its N-terminus, ankyrin repeats in the middle portion, and a FYVE-finger motif at its C-terminus. This protein belongs to a subgroup of double zinc finger proteins which may be involved in vesicle or protein transport. Alternate splicing results in multiple transcript variants of this gene. |
Synonyms | ANKHZN; DKFZp686M19106; KIAA1255; ZFYVE14 |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |