Polyserase1 (TMPRSS9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMPRSS9 Antibody is: synthetic peptide directed towards the C-terminal region of Human TMPRSS9. Synthetic peptide located within the following region: PVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	transmembrane protease, serine 9
Database Link	NP_892018 Entrez Gene 360200 Human UniProt ID Q7Z410
Background	Serase-1 and serase-2 are serine proteases that hydrolyze the peptides N-t-Boc-Gln-Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC. In contrast, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Ala-Pro-Ala-AMC are not significantly hydrolyzed.
Synonyms	FLJ16193
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Horse: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.