ZNF337 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF337 Antibody: synthetic peptide directed towards the middle region of human ZNF337. Synthetic peptide located within the following region: GEKPYECQECGRRFNDKSSYNKHLKAHSGEKPFVCKECGRGYTNKSYFVV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	87 kDa
Gene Name	zinc finger protein 337
Database Link	NP_056470 Entrez Gene 26152 Human UniProt ID Q9Y3M9
Background	The function of ZNF337 has not yet been determined.
Synonyms	OTTHUMP00000030501; OTTHUMP00000030502; zinc finger protein 337
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.