SLC35A5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC35A5 Antibody: synthetic peptide directed towards the N terminal of human SLC35A5. Synthetic peptide located within the following region: LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	solute carrier family 35 member A5
Database Link	NP_060415 Entrez Gene 55032 Human UniProt ID Q9BS91
Background	SLC35A5 belongs to the nucleotide-sugar transporter family, SLC35A subfamily. It is a multi-pass membrane protein. The function of the SLC35A5 protein remains unknown.
Synonyms	DKFZp434E102; FLJ11130; FLJ20730; FLJ25973
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.