SLC9A8 Rabbit Antibody

Specifications

Product Data
Reactivity	Human
Host	Rabbit
Immunogen	The immunogen for Anti-Slc9a8 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Slc9a8. Synthetic peptide located within the following region: LHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSF
Isotype	IgG
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Database Link	NP_056081 Entrez Gene 311651 Rat
Background	Slc9a8 is involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. It is a major proton extruding system driven by the inward sodium ion chemical gradient and plays an important role in signal transduction.
Synonyms	NHE-8; NHE8
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.