SLC9A5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Slc9a5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SFAFPPSLAKAGRSRSESSADIPQQELQPLMGHKDHTHLSPGTANSHWCI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	99 kDa
Gene Name	solute carrier family 9 member A5
Database Link	NP_004585 Entrez Gene 277973 Mouse UniProt ID Q14940
Background	The function of this protein remains unknown.
Synonyms	NHE5
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.