T Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-T Antibody: synthetic peptide directed towards the N terminal of human T. Synthetic peptide located within the following region: SSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESEL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | T brachyury transcription factor |
Database Link | |
Background | The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. |
Synonyms | SAVA; TFT |
Note | Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Dog: 92%; Rabbit: 92% |
Reference Data | |
Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |