MYSM1 Rabbit Polyclonal Antibody

CAT#: TA334332

Rabbit Polyclonal Anti-MYSM1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of Myb-like, SWIRM and MPN domains 1 (MYSM1)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human Myb-like, SWIRM and MPN domains 1 (MYSM1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human Myb-like, SWIRM and MPN domains 1 (MYSM1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MYSM1 antibody is: synthetic peptide directed towards the C-terminal region of Human MYSM1. Synthetic peptide located within the following region: CLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 91 kDa
Gene Name Myb like, SWIRM and MPN domains 1
Background MYSM1 is a metalloprotease that specifically deubiquitinates monoubiquitinated histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. It preferentially deubiquitinates monoubiquitinated H2A in hyperacetylated nucleosomes. Deubiquitination of histone H2A leads to facilitate the phosphorylation and dissociation of histone H1 from the nucleosome. MYSM1 acts as a coactivator by participating in the initiation and elongation steps of androgen receptor (AR)-induced gene activation.
Synonyms 2A-DUB; 2ADUB
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rabbit: 77%
Reference Data
Protein Families Protease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...