C12orf24 (FAM216A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM216A antibody: synthetic peptide directed towards the N terminal of human FAM216A. Synthetic peptide located within the following region: AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	family with sequence similarity 216 member A
Database Link	NP_037432 Entrez Gene 29902 Human UniProt ID Q8WUB2
Background	The exact function of FAM216A remains unknown.
Synonyms	C12orf24; HSU79274
Note	Immunogen Sequence Homology: Human: 100%; Pig: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.