RTDR1 (RSPH14) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RTDR1 antibody: synthetic peptide directed towards the N terminal of human RTDR1. Synthetic peptide located within the following region: MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	radial spoke head 14 homolog
Database Link	NP_055248 Entrez Gene 27156 Human UniProt ID Q9UHP6
Background	The specific function of the protein remains unknown.
Synonyms	RTDR1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 85%; Pig: 85%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.