C6orf120 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C6orf120 antibody is: synthetic peptide directed towards the C-terminal region of Human C6orf120. Synthetic peptide located within the following region: KVYYDGTVEQHPFGEAAYPADGADAGQKHAGAPEDASQEEESVLWTILIS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	chromosome 6 open reading frame 120
Database Link	NP_001025034 Entrez Gene 387263 Human UniProt ID Q7Z4R8
Background	C6orf120 may be involved in induction of apoptosis in CD4+ T-cells, but not CD8+ T-cells or hepatocytes.
Synonyms	bA160E12.4
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.