SCML4 Rabbit Polyclonal Antibody
CAT#: TA335343
Rabbit Polyclonal Anti-SCML4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SCML4 Antibody: synthetic peptide directed towards the N terminal of human SCML4. Synthetic peptide located within the following region: EPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | sex comb on midleg-like 4 (Drosophila) |
Database Link | |
Background | SCML4 is a putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. |
Synonyms | dJ47M23.1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 86%; Horse: 86%; Rabbit: 86%; Mouse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |