KDM4E Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KDM4E antibody is: synthetic peptide directed towards the N-terminal region of Human KDM4E. Synthetic peptide located within the following region: YDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	lysine demethylase 4E
Database Link	NP_001155102 Entrez Gene 390245 Human UniProt ID B2RXH2
Background	KDM4E is a histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code.
Synonyms	JMJD2E; KDM4DL
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Dog: 83%; Pig: 83%; Horse: 83%; Bovine: 83%; Guinea pig: 83%; Zebrafish: 79%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.