C10orf78 (SFR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SFR1 antibody is: synthetic peptide directed towards the N-terminal region of Human SFR1. Synthetic peptide located within the following region: NSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPAS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	SWI5 dependent homologous recombination repair protein 1
Database Link	NP_660290 Entrez Gene 119392 Human UniProt ID Q86XK3
Background	SFR1 is a component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination.
Synonyms	bA373N18.1; C10orf78; MEI5; MEIR5
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 85%; Rat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.