FAM101A (RFLNA) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM101A antibody: synthetic peptide directed towards the middle region of human FAM101A. Synthetic peptide located within the following region: QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	family with sequence similarity 101 member A
Database Link	NP_859060 Entrez Gene 144347 Human UniProt ID Q6ZTI6
Background	FAM101A belongs to the FAM101 family. The exact function of FAM101A remains unknown.
Synonyms	CFM2; FAM101A
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 86%; Rat: 86%; Mouse: 86%; Horse: 85%; Guinea pig: 85%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.