THAP5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-THAP5 antibody: synthetic peptide directed towards the middle region of human THAP5. Synthetic peptide located within the following region: TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	THAP domain containing 5
Database Link	NP_001123947 Entrez Gene 168451 Human UniProt ID Q7Z6K1
Background	THAP5 contains 1 THAP-type zinc finger. The exact function of THAP5 remains unknown.
Synonyms	DKFZp313O1132
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Pig: 79%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.