PRKAR1B Rabbit Polyclonal Antibody

CAT#: TA337697

Rabbit Polyclonal Anti-PRKAR1B Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 1
    • 100 ug

CNY 3080.00


Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 2
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse, Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PRKAR1B antibody: synthetic peptide directed towards the middle region of human PRKAR1B. Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 43 kDa
Gene Name protein kinase cAMP-dependent type I regulatory subunit beta
Background Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion transport, and gene transcription. The PKA holoenzyme is composed of 2 regulatory and 2 catalytic subunits and dissociates from the regulatory subunits upon binding of cAMP. [supplied by OMIM, Jun 2009]. Transcript Variant: This variant (4) differs in the 5' UTR compared to variant 1. All 6 variants encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## CDS exon combination :: AL833563.1, BC026734.1 [ECO:0000331] RNAseq introns :: mixed/partial sample support ERS025087, ERS025093 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms PRKAR1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 92%; Sheep: 85%; Rabbit: 85%
Reference Data
Protein Families Druggable Genome
Protein Pathways Apoptosis, Insulin signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...