Arpc5 Rabbit Polyclonal Antibody
CAT#: TA337971
Rabbit Polyclonal Anti-Arpc5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Arpc5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Arpc5. Synthetic peptide located within the following region: VDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 16 kDa |
Gene Name | actin related protein 2/3 complex, subunit 5 |
Database Link | |
Background | Arpc5 functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. |
Synonyms | ARC16; dJ127C7.3; MGC88523; p16-Arc |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |