EHM2 (EPB41L4B) Rabbit Polyclonal Antibody
CAT#: TA338037
Rabbit Polyclonal Anti-EPB41L4B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EPB41L4B antibody is: synthetic peptide directed towards the middle region of Human EPB41L4B. Synthetic peptide located within the following region: AELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAEL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | erythrocyte membrane protein band 4.1 like 4B |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | CG1; EHM2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |