GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
CAT#: TA338295
Rabbit Polyclonal Anti-CSF2RA Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CSF2RA antibody is: synthetic peptide directed towards the C-terminal region of Human CSF2RA. Synthetic peptide located within the following region: VLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIW |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | colony stimulating factor 2 receptor alpha subunit |
Database Link | |
Background | The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. |
Synonyms | CD116; CDw116; CSF2R; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM-CSF-R-alpha; GMCSFR; GMR; SMDP4 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway, Pathways in cancer |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它GM CSF Receptor alpha产品