UBASH3A Rabbit Polyclonal Antibody

CAT#: TA338904

Rabbit Polyclonal Anti-UBASH3A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of ubiquitin associated and SH3 domain containing, A (UBASH3A), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human ubiquitin associated and SH3 domain containing, A (UBASH3A), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human ubiquitin associated and SH3 domain containing, A (UBASH3A), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-UBASH3A antibody: synthetic peptide directed towards the middle region of human UBASH3A. Synthetic peptide located within the following region: PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 74 kDa
Gene Name ubiquitin associated and SH3 domain containing A
Background This gene encodes one of two family members belonging to the T-cell ubiquitin ligand (TULA) family. Both family members can negatively regulate T-cell signaling. This family member can facilitate growth factor withdrawal-induced apoptosis in T cells, which may occur via its interaction with AIF, an apoptosis-inducing factor. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Aug 2011]
Synonyms CLIP4; STS-2; TULA; TULA-1
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Pig: 86%; Yeast: 82%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...