TAF3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TAF3 antibody: synthetic peptide directed towards the middle region of human TAF3. Synthetic peptide located within the following region: RDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	103 kDa
Gene Name	TATA-box binding protein associated factor 3
Database Link	NP_114129 Entrez Gene 83860 Human UniProt ID Q5VWG9
Background	Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAF3 is required in complex with TBPL2 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.
Synonyms	TAF140; TAFII-140; TAFII140
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Zebrafish: 85%; Dog: 79%; Yeast: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.