C16orf48 (ENKD1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C16orf48 antibody: synthetic peptide directed towards the C terminal of human C16orf48. Synthetic peptide located within the following region: DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	enkurin domain containing 1
Database Link	NP_115516 Entrez Gene 84080 Human UniProt ID Q9H0I2
Background	The exact function of ENKD1 remains unknown.
Synonyms	C16orf48; DAKV6410
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Dog: 86%; Bovine: 86%; Horse: 85%; Mouse: 83%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.