C14orf174 (SAMD15) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C14orf174 antibody: synthetic peptide directed towards the N terminal of human C14orf174. Synthetic peptide located within the following region: FPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	sterile alpha motif domain containing 15
Database Link	NP_001010860 Entrez Gene 161394 Human UniProt ID Q9P1V8
Background	C14orf174 contains 1 SAM (sterile alpha motif) domain. The exact functions of C14orf174 remain unknown.
Synonyms	C14orf174; FAM15A
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 83%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.