EIF2B1 Rabbit Polyclonal Antibody
CAT#: TA340021
Rabbit Polyclonal Anti-EIF2B1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EIF2B1 antibody: synthetic peptide directed towards the C terminal of human EIF2B1. Synthetic peptide located within the following region: ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | eukaryotic translation initiation factor 2B subunit alpha |
Database Link | |
Background | EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM). |
Synonyms | EIF2B; EIF2BA |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%; Rabbit: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |