CHN 1 (CHN1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHN1 antibody: synthetic peptide directed towards the middle region of human CHN1. Synthetic peptide located within the following region: KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	chimerin 1
Database Link	NP_001813 Entrez Gene 1123 Human UniProt ID P15882
Background	CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.
Synonyms	ARHGAP2; CHN; DURS2; NC; RHOGAP2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Zebrafish: 86%; Yeast: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.