TBL3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TBL3 antibody: synthetic peptide directed towards the N terminal of human TBL3. Synthetic peptide located within the following region: MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	89 kDa
Gene Name	transducin beta like 3
Database Link	NP_006444 Entrez Gene 10607 Human UniProt ID Q12788
Background	The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate prot
Synonyms	SAZD; UTP13
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 91%; Dog: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.