SIGLEC9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SIGLEC9 antibody: synthetic peptide directed towards the C terminal of human SIGLEC9. Synthetic peptide located within the following region: PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	sialic acid binding Ig like lectin 9
Database Link	NP_055256 Entrez Gene 27180 Human UniProt ID Q9Y336
Background	Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid.The sialic acid recognition site may be masked by cis interactions with sialic acids onThe same cell surface.
Synonyms	CD329; CDw329; FOAP-9; OBBP-LIKE; siglec-9
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.