EDEM1 Rabbit Polyclonal Antibody
CAT#: TA341949
Rabbit Polyclonal Anti-EDEM1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EDEM1 antibody: synthetic peptide directed towards the N terminal of human EDEM1. Synthetic peptide located within the following region: MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 74 kDa |
Gene Name | ER degradation enhancing alpha-mannosidase like protein 1 |
Database Link | |
Background | EDEM1 belongs toThe glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, fromThe calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner. |
Synonyms | EDEM |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Yeast: 82% |
Reference Data | |
Protein Families | Transmembrane |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Amyloid-beta Degradation and Neuroprotection of Dauricine Mediated by Unfolded Protein Response in a Caenorhabditis elegans model of Alzheimer's disease
,Pu, Z;Ma, S;Wang, L;Li, M;Shang, L;Luo, Y;Chen, W;,
Neuroscience
,PubMed ID 30267833
[EDEM1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |