TEX264 Rabbit Polyclonal Antibody
CAT#: TA341988
Rabbit Polyclonal Anti-TEX264 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TEX264 antibody: synthetic peptide directed towards the middle region of human TEX264. Synthetic peptide located within the following region: SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | testis expressed 264 |
Database Link | |
Background | The specific function of TEX264 is not yet known. |
Synonyms | ZSIG11 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93% |
Reference Data | |
Protein Families | Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |