IMPG2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IMPG2 antibody: synthetic peptide directed towards the C terminal of human IMPG2. Synthetic peptide located within the following region: VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	138 kDa
Gene Name	interphotoreceptor matrix proteoglycan 2
Database Link	NP_057331 Entrez Gene 50939 Human UniProt ID Q9BZV3
Background	The protein encoded byThis gene binds chondroitin sulfate and hyaluronan and is a proteoglycan.The encoded protein plays a role inThe organization ofThe interphotoreceptor matrix and may promoteThe growth and maintenance ofThe light-sensitive photoreceptor outer segment. Defects inThis gene are a cause of retinitis pigmentosa type 56 and maculopathy, IMPG2-related. [provided by RefSeq, Mar 2011]
Synonyms	IPM200; RP56; SPACRCAN; VMD5
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.