CARKD (NAXD) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CARKD antibody: synthetic peptide directed towards the middle region of human CARKD. Synthetic peptide located within the following region: RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	NAD(P)HX dehydratase
Database Link	NP_060680 Entrez Gene 55739 Human UniProt ID Q8IW45
Background	The exact function of FLJ10769 remains unknown.
Synonyms	CARKD; LP3298
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Rabbit: 92%; Yeast: 85%; Zebrafish: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.