IL20RB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Il20rb antibody is: synthetic peptide directed towards the middle region of Mouse Il20rb. Synthetic peptide located within the following region: LEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	interleukin 20 receptor subunit beta
Database Link	NP_653318 Entrez Gene 213208 Mouse UniProt ID Q6UXL0
Background	The function of this protein remains unknown.
Synonyms	DIRS1; FNDC6; IL-20R2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 92%; Dog: 86%; Horse: 86%; Rabbit: 86%; Bovine: 85%; Rat
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.