TIMELESS Rabbit Polyclonal Antibody

CAT#: TA343434

Rabbit Polyclonal Anti-TIMELESS Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,381.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of timeless homolog (Drosophila) (TIMELESS)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human timeless homolog (Drosophila) (TIMELESS), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human timeless homolog (Drosophila) (TIMELESS), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TIMELESS antibody: synthetic peptide directed towards the N terminal of human TIMELESS. Synthetic peptide located within the following region: MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 139 kDa
Gene Name timeless circadian clock
Background The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.
Synonyms hTIM; TIM; TIM1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...