TIMELESS Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TIMELESS antibody: synthetic peptide directed towards the C terminal of human TIMELESS. Synthetic peptide located within the following region: EEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	139 kDa
Gene Name	timeless circadian clock
Database Link	NP_003911 Entrez Gene 8914 Human UniProt ID Q9UNS1
Background	The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.
Synonyms	hTIM; TIM; TIM1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Dog: 93%; Yeast: 91%; Mouse: 90%; Pig: 83%; Horse: 83%; Guinea pig: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.