PEG3 Rabbit Polyclonal Antibody
CNY 5250.00
Cited in 2 publications. |
CNY 300.00
CNY 1430.00
CNY 4840.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PEG3 antibody: synthetic peptide directed towards the C terminal of human PEG3. Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 181 kDa |
Gene Name | paternally expressed 3 |
Database Link | |
Background | PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells. |
Synonyms | PW1; ZKSCAN22; ZNF904; ZSCAN24 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Citations (2)
The use of this Antibodies has been cited in the following citations: |
---|
Embryonic Trophectoderm Secretomics Reveals Chemotactic Migration and Intercellular Communication of Endometrial and Circulating MSCs in Embryonic Implantation
,null,
International Journal of Molecular Sciences
,PubMed ID 34073234
[PEG3]
|
Embryonic trophectoderm secretomics reveals chemotactic migration and intercellular communication of endometrial and circulating MSCs in embryonic implantation
,Calle, A;Toribio-Serrano, V;Yáñez-Mó, M;Ramírez, M;,
Research Square
[PEG3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |