Naked1 (NKD1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NKD1 antibody: synthetic peptide directed towards the N terminal of human NKD1. Synthetic peptide located within the following region: ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	naked cuticle homolog 1
Database Link	NP_149110 Entrez Gene 85407 Human UniProt ID Q969G9
Background	In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway. [supplied by OMIM]
Synonyms	Naked1
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Rat: 92%; Mouse: 85%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.