AKR1B10 Rabbit Polyclonal Antibody

CAT#: TA344167

Rabbit Polyclonal Anti-AKR1B10 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4381.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-AKR1B10 antibody: synthetic peptide directed towards the N terminal of human AKR1B10. Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name aldo-keto reductase family 1, member B10 (aldose reductase)
Background AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Synonyms AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Zebrafish: 100%; Rat: 93%; Bovine: 93%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Butanoate metabolism, Fructose and mannose metabolism, Linoleic acid metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...