SMARCD1 Rabbit Polyclonal Antibody
CAT#: TA344378
Rabbit Polyclonal Anti-SMARCD1 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SMARCD1 antibody: synthetic peptide directed towards the middle region of human SMARCD1. Synthetic peptide located within the following region: RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 58 kDa |
| Gene Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 |
| Database Link | |
| Background | SMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene. |
| Synonyms | BAF60A; CRACD1; Rsc6p |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
其它SMARCD1产品
