ZNF44 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF44 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF44. Synthetic peptide located within the following region: NLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIVNKNTPARVDACGSSV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	zinc finger protein 44
Database Link	NP_001157748 Entrez Gene 51710 Human UniProt ID P15621
Background	ZNF44 may be involved in transcriptional regulation.
Synonyms	GIOT-2; KOX7; ZNF; ZNF55; ZNF58; ZNF504
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.