KIAA1430 (CFAP97) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIAA1430 antibody: synthetic peptide directed towards the middle region of human KIAA1430. Synthetic peptide located within the following region: NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	cilia and flagella associated protein 97
Database Link	NP_065878 Entrez Gene 57587 Human UniProt ID Q9P2B7
Background	The function of this protein remains unknown.
Synonyms	hmw; KIAA1430
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 87%; Bovine: 80%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.