PGBD1 Rabbit Polyclonal Antibody
CAT#: TA345445
Rabbit Polyclonal Anti-PGBD1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the N terminal of human PGBD1. Synthetic peptide located within the following region: MYEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 93 kDa |
Gene Name | piggyBac transposable element derived 1 |
Database Link | |
Background | PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. |
Synonyms | dJ874C20.4; HUCEP-4; SCAND4 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 92%; Rabbit: 92%; Horse: 75% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |