ZNF396 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF396 antibody: synthetic peptide directed towards the N terminal of human ZNF396. Synthetic peptide located within the following region: TQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	zinc finger protein 396
Database Link	NP_665699 Entrez Gene 252884 Human UniProt ID Q96N95
Background	ZNF396 acts as a DNA-dependent transcriptional repressor.
Synonyms	ZSCAN14
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Dog: 90%; Pig: 90%; Rat: 90%; Horse: 90%; Mouse: 90%; Bovine: 90%; Guinea pig: 90%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.