Tbx18 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tbx18 antibody is: synthetic peptide directed towards the N-terminal region of RAT Tbx18. Synthetic peptide located within the following region: GPARSCTDAERSCASRGPAGSCEDGFLQGASPLASPGGSPKGSPVPGLAR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	T-box18
Database Link	NP_001101643 Entrez Gene 315870 Rat
Background	The function of this protein remains unknown.
Synonyms	2810012F10Rik; 2810404D13Rik
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Human: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.