SNRPD2 Rabbit Polyclonal Antibody

CAT#: TA345887

Rabbit Polyclonal Anti-SNRPD2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the middle region of human SNRPD2. Synthetic peptide located within the following region: ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 13 kDa
Gene Name small nuclear ribonucleoprotein D2 polypeptide
Background SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Synonyms Sm-D2; SMD2; SNRPD1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%
Reference Data
Protein Pathways Spliceosome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...