CELF2 Rabbit Polyclonal Antibody

CAT#: TA345978

Rabbit Polyclonal Anti-CUGBP2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00


Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 3
    • 100 ug

CNY 4840.00


Recombinant protein of human CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications WB
Recommend Dilution IHC, WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CUGBP2 antibody: synthetic peptide directed towards the N terminal of human CUGBP2. Synthetic peptide located within the following region: TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name CUGBP, Elav-like family member 2
Background CUGBP2 is a member of the CELF/BRUNOL protein family, which contains two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of CUGBP2 family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. If alternative splicing were to result, multiple transcript variants encoding different isoforms would appear.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Synonyms BRUNOL3; CUGBP2; ETR-3; ETR3; NAPOR
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...